PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G023602.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB_related
Protein Properties Length: 247aa    MW: 27181.7 Da    PI: 4.8894
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G023602.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.4e-13246347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          +WT+eE+ l++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  HL.SW.v1.0.G023602.1  2 PWTEEEHRLFLIGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY 46
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-6149IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.2E-18150IPR006447Myb domain, plants
PROSITE profilePS5129422.052151IPR017930Myb domain
SuperFamilySSF466891.2E-15252IPR009057Homeodomain-like
CDDcd001671.36E-9247No hitNo description
PfamPF002495.9E-11246IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-11245IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
VPWTEEEHRL FLIGLQKLGK GDWRGIARNY VVSRTPTQVA SHAQKYFIRQ SNATRRKRRS  60
SLFDMVPDMA SDPPPVPEED LLPSFQETEA DNAKSLPSLN LSLQSECEPM EATHDTKVEE  120
DQDPVLGSNG FPPMVPGLSG FFPAYMPVPF SLWPPSAAPL EEQRIAETTQ HQVLKPIPIV  180
AKEPVDVNEL VGMSQLSLGE AERGHREPSP LSLKLLGEPS RQSAFHSNAP VSGSDLSEGK  240
TSPIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902398.11e-138PREDICTED: uncharacterized protein LOC107435329
RefseqXP_015902404.11e-138PREDICTED: uncharacterized protein LOC107435334
TrEMBLW9R6M01e-137W9R6M0_9R
STRINGGLYMA13G43120.11e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-71MYB_related family protein